Lineage for d2pb9b1 (2pb9 B:268-451)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 843699Fold c.74: AraD/HMP-PK domain-like [53638] (1 superfamily)
    3 layers: a/b/a; mixed (mostly antiparallel) beta-sheet of 9 strands, order 432159876; left-handed crossover between strands 4 and 5
  4. 843700Superfamily c.74.1: AraD/HMP-PK domain-like [53639] (2 families) (S)
  5. 843761Family c.74.1.2: Phosphomethylpyrimidine kinase C-terminal domain-like [159768] (2 proteins)
  6. 843762Protein Phosphomethylpyrimidine kinase [159769] (1 species)
  7. 843763Species Pyrococcus furiosus [TaxId:2261] [159770] (1 PDB entry)
    Uniprot Q8U193 268-451
  8. 843765Domain d2pb9b1: 2pb9 B:268-451 [149353]
    automatically matched to 2PB9 A:268-451
    complexed with po4

Details for d2pb9b1

PDB Entry: 2pb9 (more details), 2.7 Å

PDB Description: crystal structure of c-terminal domain of phosphomethylpyrimidine kinase
PDB Compounds: (B:) phosphomethylpyrimidine kinase

SCOP Domain Sequences for d2pb9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pb9b1 c.74.1.2 (B:268-451) Phosphomethylpyrimidine kinase {Pyrococcus furiosus [TaxId: 2261]}
ekwriyeeltnavrefesinpvrlipevgtnfvyslplpyarstkdvagvkgrivkygns
vkavgpvefgasdhlaravltymrfypeyrsainirysreiieeiieiaqergfkvsfyd
rreepeeikakegatipwgietaikrikerpdiiyhlgdvgkepmilvfgrnprevleki
kmli

SCOP Domain Coordinates for d2pb9b1:

Click to download the PDB-style file with coordinates for d2pb9b1.
(The format of our PDB-style files is described here.)

Timeline for d2pb9b1: