SCOPe 2.02: Domain d2pakb_: 2pak B:

Lineage for d2pakb_ (2pak B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.1: dTDP-sugar isomerase [51183] (5 proteins)

6. Protein dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA [159287] (1 species)

7. Species Aneurinibacillus thermoaerophilus [TaxId:143495] [159288] (4 PDB entries)
   Uniprot Q6T1W8 1-136! Uniprot Q6T1W8 2-136

8. Domain d2pakb_: 2pak B: [149347]
   automated match to d2paka1
   complexed with tyd; mutant

Details for d2pakb_

PDB Entry: 2pak, 2.4 Å

PDB Description: structure of a h51n mutant dtdp-4-keto-6-deoxy-d-glucose-3,4- ketoisomerase from aneurinibacillus thermoaerophilus complexed with tdp

PDB Compounds: (B:) DTDP-6-deoxy-3,4-keto-hexulose isomerase

SCOPe Domain Sequences for d2pakb_:

Sequence; same for both SEQRES and ATOM records:

>d2pakb_ b.82.1.1 (B:) dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Aneurinibacillus thermoaerophilus [TaxId: 143495]}
enkvinfkkiidsrgslvaieenknipfsikrvyyifdtkgeeprgfhankkleqvlvcl
ngscrvilddgniiqeitldspavglyvgpavwhemhdfssdcvmmvlasdyydetdyir
qydnfkkyiakinl

Timeline for d2pakb_:

• d2pakb_ first appeared in SCOP 1.75, called d2pakb1
  
• d2pakb_ appears in SCOPe 2.01
  
• d2pakb_ appears in SCOPe 2.03
  
• d2pakb_ appears in the current release, SCOPe 2.08