| Class b: All beta proteins [48724] (180 folds) |
| Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) ![]() |
| Family b.82.1.1: dTDP-sugar isomerase [51183] (5 proteins) |
| Protein dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA [159287] (1 species) |
| Species Aneurinibacillus thermoaerophilus [TaxId:143495] [159288] (4 PDB entries) Uniprot Q6T1W8 1-136! Uniprot Q6T1W8 2-136 |
| Domain d2paka1: 2pak A:2-136 [149346] complexed with tyd; mutant |
PDB Entry: 2pak (more details), 2.4 Å
SCOPe Domain Sequences for d2paka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2paka1 b.82.1.1 (A:2-136) dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Aneurinibacillus thermoaerophilus [TaxId: 143495]}
enkvinfkkiidsrgslvaieenknipfsikrvyyifdtkgeeprgfhankkleqvlvcl
ngscrvilddgniiqeitldspavglyvgpavwhemhdfssdcvmmvlasdyydetdyir
qydnfkkyiakinle
Timeline for d2paka1: