Lineage for d2paja2 (2paj A:70-405)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2084338Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2084764Family c.1.9.9: SAH/MTA deaminase-like [82258] (3 protein domains)
    automatically mapped to Pfam PF01979
  6. 2084774Protein Hypothetical protein GOS_1943094 [159389] (1 species)
  7. 2084775Species Environmental samples [TaxId:33858] [159390] (1 PDB entry)
  8. 2084776Domain d2paja2: 2paj A:70-405 [149345]
    Other proteins in same PDB: d2paja1
    complexed with zn

Details for d2paja2

PDB Entry: 2paj (more details), 2.7 Å

PDB Description: Crystal structure of an amidohydrolase from an environmental sample of Sargasso sea
PDB Compounds: (A:) putative cytosine/guanine deaminase

SCOPe Domain Sequences for d2paja2:

Sequence, based on SEQRES records: (download)

>d2paja2 c.1.9.9 (A:70-405) Hypothetical protein GOS_1943094 {Environmental samples [TaxId: 33858]}
pawvnthhhlfqsllkgepagldatltpwlaatpyrfralfderrfrlaariglielars
gcatvadhnyvyypgmpfdssailfeeaeklglrfvllrggatqtrqleadlptalrpet
ldayvadierlaaryhdaspramrrvvmapttvlysispremretaavarrlglrmhshl
setvgyqdsaysmygkspvafcgehdwlgsdvwyahlvkvdadeiallaqtgtgvahcpq
sngrlgsgicpvremadagvpvsigvdgaasneaadmisevhmtwlaqrarlgmlaqpay
rggsfeggagaasiaevihwgtaggarvmgldevgk

Sequence, based on observed residues (ATOM records): (download)

>d2paja2 c.1.9.9 (A:70-405) Hypothetical protein GOS_1943094 {Environmental samples [TaxId: 33858]}
pawvnthhhlfqsllkgepfralfderrfrlaariglielarsgcatvadhnyvyypgmp
fdssailfeeaeklglrfvllrggatqtrqleadlptalrpetldayvadierlaaryhd
aspramrrvvmapttvlysispremretaavarrlglrmhshlsgkspvafcgehdwlgs
dvwyahlvkvdadeiallaqtgtgvahcpqsngrlpvremadagvpvsigvdgaasneaa
dmisevhmtwlaqrarlasiaevihwgtaggarvmgldevgk

SCOPe Domain Coordinates for d2paja2:

Click to download the PDB-style file with coordinates for d2paja2.
(The format of our PDB-style files is described here.)

Timeline for d2paja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2paja1