Lineage for d2paja1 (2paj A:10-69,A:406-484)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 811542Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 811543Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (11 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 811656Family b.92.1.4: SAH/MTA deaminase-like [82224] (3 proteins)
  6. 811665Protein Hypothetical protein GOS_1943094 [159334] (1 species)
  7. 811666Species Environmental samples [TaxId:33858] [159335] (1 PDB entry)
  8. 811667Domain d2paja1: 2paj A:10-69,A:406-484 [149344]
    Other proteins in same PDB: d2paja2
    complexed with zn

Details for d2paja1

PDB Entry: 2paj (more details), 2.7 Å

PDB Description: crystal structure of an amidohydrolase from an environmental sample of sargasso sea
PDB Compounds: (A:) putative cytosine/guanine deaminase

SCOP Domain Sequences for d2paja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2paja1 b.92.1.4 (A:10-69,A:406-484) Hypothetical protein GOS_1943094 {Environmental samples}
pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviy
Xvavgyaadiavyrlddpryfglhdpaigpvasggrpsvmalfsagkrvvvddliegvdi
kelggearrvvrellrevvv

SCOP Domain Coordinates for d2paja1:

Click to download the PDB-style file with coordinates for d2paja1.
(The format of our PDB-style files is described here.)

Timeline for d2paja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2paja2