![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
![]() | Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) ![]() this domain is interrupted by the catalytic beta/alpha barrel domain |
![]() | Family b.92.1.4: SAH/MTA deaminase-like [82224] (3 proteins) |
![]() | Protein Hypothetical protein GOS_1943094 [159334] (1 species) |
![]() | Species Environmental samples [TaxId:33858] [159335] (1 PDB entry) |
![]() | Domain d2paja1: 2paj A:10-69,A:406-484 [149344] Other proteins in same PDB: d2paja2 complexed with zn |
PDB Entry: 2paj (more details), 2.7 Å
SCOPe Domain Sequences for d2paja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2paja1 b.92.1.4 (A:10-69,A:406-484) Hypothetical protein GOS_1943094 {Environmental samples [TaxId: 33858]} pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviy Xvavgyaadiavyrlddpryfglhdpaigpvasggrpsvmalfsagkrvvvddliegvdi kelggearrvvrellrevvv
Timeline for d2paja1: