Lineage for d2paga1 (2pag A:1-135)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011681Fold d.369: SMI1/KNR4-like [160630] (1 superfamily)
    alpha(4)-beta(4)-alpha; 3 layers: a/b/a; antiparallel beta-sheet, order 1234(meander)
  4. 3011682Superfamily d.369.1: SMI1/KNR4-like [160631] (1 family) (S)
  5. 3011683Family d.369.1.1: SMI1/KNR4-like [160632] (3 proteins)
    Pfam PF09346
  6. 3011684Protein Hypothetical protein PSPTO5518 [160635] (1 species)
  7. 3011685Species Pseudomonas syringae pv. tomato [TaxId:323] [160636] (1 PDB entry)
    Uniprot Q87TZ9 1-135
  8. 3011686Domain d2paga1: 2pag A:1-135 [149343]
    complexed with ca

Details for d2paga1

PDB Entry: 2pag (more details), 1.6 Å

PDB Description: crystal structure of protein pspto_5518 from pseudomonas syringae pv. tomato
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2paga1:

Sequence, based on SEQRES records: (download)

>d2paga1 d.369.1.1 (A:1-135) Hypothetical protein PSPTO5518 {Pseudomonas syringae pv. tomato [TaxId: 323]}
leevieqlreanepvpvplelpdedqlveieeqlfinipfvfkeflltvsdvvygslepv
tvtdpqshtylpevcatawdlgvprelipicqdgedyycveedgtvllwsaeeelvtees
wesvwhwardvwles

Sequence, based on observed residues (ATOM records): (download)

>d2paga1 d.369.1.1 (A:1-135) Hypothetical protein PSPTO5518 {Pseudomonas syringae pv. tomato [TaxId: 323]}
leevieqlreanepvpvplelpdedqlveieeqlfinipfvfkeflltvsdvvygslepv
tvtdpqshtylpevcatawdlgvprelipicqdgedyycveedgtvllwsalvteeswes
vwhwardvwles

SCOPe Domain Coordinates for d2paga1:

Click to download the PDB-style file with coordinates for d2paga1.
(The format of our PDB-style files is described here.)

Timeline for d2paga1: