Lineage for d2paeb_ (2pae B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1138044Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1138045Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 1138046Family b.82.1.1: dTDP-sugar isomerase [51183] (5 proteins)
  6. 1138107Protein dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA [159287] (1 species)
  7. 1138108Species Aneurinibacillus thermoaerophilus [TaxId:143495] [159288] (4 PDB entries)
    Uniprot Q6T1W8 1-136! Uniprot Q6T1W8 2-136
  8. 1138114Domain d2paeb_: 2pae B: [149342]
    automated match to d2paea1
    complexed with tyd; mutant

Details for d2paeb_

PDB Entry: 2pae (more details), 2.5 Å

PDB Description: structure of a h49n mutant dtdp-4-keto-6-deoxy-d-glucose-3,4- ketoisomerase from aneurinibacillus thermoaerophilus in complex with tdp
PDB Compounds: (B:) DTDP-6-deoxy-3,4-keto-hexulose isomerase

SCOPe Domain Sequences for d2paeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2paeb_ b.82.1.1 (B:) dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Aneurinibacillus thermoaerophilus [TaxId: 143495]}
enkvinfkkiidsrgslvaieenknipfsikrvyyifdtkgeeprgfnahkkleqvlvcl
ngscrvilddgniiqeitldspavglyvgpavwhemhdfssdcvmmvlasdyydetdyir
qydnfkkyiakinl

SCOPe Domain Coordinates for d2paeb_:

Click to download the PDB-style file with coordinates for d2paeb_.
(The format of our PDB-style files is described here.)

Timeline for d2paeb_: