SCOPe 2.05: Domain d2paea1: 2pae A:1-136

Lineage for d2paea1 (2pae A:1-136)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.1: dTDP-sugar isomerase [51183] (5 proteins)

6. Protein dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA [159287] (1 species)

7. Species Aneurinibacillus thermoaerophilus [TaxId:143495] [159288] (4 PDB entries)
   Uniprot Q6T1W8 1-136! Uniprot Q6T1W8 2-136

8. Domain d2paea1: 2pae A:1-136 [149341]
   complexed with tyd; mutant

Details for d2paea1

PDB Entry: 2pae, 2.5 Å

PDB Description: structure of a h49n mutant dtdp-4-keto-6-deoxy-d-glucose-3,4- ketoisomerase from aneurinibacillus thermoaerophilus in complex with tdp

PDB Compounds: (A:) DTDP-6-deoxy-3,4-keto-hexulose isomerase

SCOPe Domain Sequences for d2paea1:

Sequence; same for both SEQRES and ATOM records:

>d2paea1 b.82.1.1 (A:1-136) dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Aneurinibacillus thermoaerophilus [TaxId: 143495]}
menkvinfkkiidsrgslvaieenknipfsikrvyyifdtkgeeprgfnahkkleqvlvc
lngscrvilddgniiqeitldspavglyvgpavwhemhdfssdcvmmvlasdyydetdyi
rqydnfkkyiakinle

Timeline for d2paea1:

• d2paea1 first appeared in SCOP 1.75
  
• d2paea1 appears in SCOPe 2.04
  
• d2paea1 appears in SCOPe 2.06
  
• d2paea1 appears in the current release, SCOPe 2.08