Lineage for d2paea1 (2pae A:1-136)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 809734Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 809735Superfamily b.82.1: RmlC-like cupins [51182] (24 families) (S)
  5. 809736Family b.82.1.1: dTDP-sugar isomerase [51183] (4 proteins)
  6. 809781Protein dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA [159287] (1 species)
  7. 809782Species Aneurinibacillus thermoaerophilus [TaxId:143495] [159288] (4 PDB entries)
    Uniprot Q6T1W8 1-136! Uniprot Q6T1W8 2-136
  8. 809785Domain d2paea1: 2pae A:1-136 [149341]
    complexed with tyd; mutant

Details for d2paea1

PDB Entry: 2pae (more details), 2.5 Å

PDB Description: structure of a h49n mutant dtdp-4-keto-6-deoxy-d-glucose-3,4- ketoisomerase from aneurinibacillus thermoaerophilus in complex with tdp
PDB Compounds: (A:) DTDP-6-deoxy-3,4-keto-hexulose isomerase

SCOP Domain Sequences for d2paea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2paea1 b.82.1.1 (A:1-136) dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Aneurinibacillus thermoaerophilus [TaxId: 143495]}
menkvinfkkiidsrgslvaieenknipfsikrvyyifdtkgeeprgfnahkkleqvlvc
lngscrvilddgniiqeitldspavglyvgpavwhemhdfssdcvmmvlasdyydetdyi
rqydnfkkyiakinle

SCOP Domain Coordinates for d2paea1:

Click to download the PDB-style file with coordinates for d2paea1.
(The format of our PDB-style files is described here.)

Timeline for d2paea1: