SCOP 1.75: Domain d2pa7b1: 2pa7 B:2-135

Lineage for d2pa7b1 (2pa7 B:2-135)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (24 families)

5. Family b.82.1.1: dTDP-sugar isomerase [51183] (4 proteins)

6. Protein dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA [159287] (1 species)

7. Species Aneurinibacillus thermoaerophilus [TaxId:143495] [159288] (4 PDB entries)
   Uniprot Q6T1W8 1-136! Uniprot Q6T1W8 2-136

8. Domain d2pa7b1: 2pa7 B:2-135 [149340]
   automatically matched to 2PA7 A:2-136
   complexed with cl, edo, tyd

Details for d2pa7b1

PDB Entry: 2pa7, 1.5 Å

PDB Description: Structure of Wild-Type dTDP-4-keto-6-deoxy-D-glucose-3,4-ketoisomerase from Aneurinibacillus thermoaerophilus in complex with TDP

PDB Compounds: (B:) DTDP-6-deoxy-3,4-keto-hexulose isomerase

SCOP Domain Sequences for d2pa7b1:

Sequence; same for both SEQRES and ATOM records:

>d2pa7b1 b.82.1.1 (B:2-135) dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Aneurinibacillus thermoaerophilus [TaxId: 143495]}
enkvinfkkiidsrgslvaieenknipfsikrvyyifdtkgeeprgfhahkkleqvlvcl
ngscrvilddgniiqeitldspavglyvgpavwhemhdfssdcvmmvlasdyydetdyir
qydnfkkyiakinl

Timeline for d2pa7b1:

• d2pa7b1 is new in SCOP 1.75
  
• d2pa7b1 is called d2pa7b_ in SCOPe 2.01
  
• d2pa7b1 appears in the current release, SCOPe 2.08, called d2pa7b_