SCOPe 2.04: Domain d2pa2b1: 2pa2 B:40-176

Lineage for d2pa2b1 (2pa2 B:40-176)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families)

5. Family d.41.4.1: Ribosomal protein L10e [54687] (1 protein)

6. Protein Ribosomal protein L10e [54688] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [160195] (1 PDB entry)
   Uniprot P27635 40-176

8. Domain d2pa2b1: 2pa2 B:40-176 [149338]
   automatically matched to 2PA2 A:40-176
   complexed with k

Details for d2pa2b1

PDB Entry: 2pa2, 2.5 Å

PDB Description: crystal structure of human ribosomal protein l10 core domain

PDB Compounds: (B:) 60S ribosomal protein L10

SCOPe Domain Sequences for d2pa2b1:

Sequence, based on SEQRES records:

>d2pa2b1 d.41.4.1 (B:40-176) Ribosomal protein L10e {Human (Homo sapiens) [TaxId: 9606]}
kakvdefplcghmvsdeyeqlssealeaaricankymvkscgkdgfhirvrlhpfhviri
nkmlscagadrlqtgmrgafgkpqgtvarvhigqvimsirtklqnkehviealrrakfkf
pgrqkihiskkwgftkf

Sequence, based on observed residues (ATOM records):

>d2pa2b1 d.41.4.1 (B:40-176) Ribosomal protein L10e {Human (Homo sapiens) [TaxId: 9606]}
kakvdefplcghmvsdeyeqlssealeaaricankymvkscgkdgfhirvrlhpfgtvar
vhigqvimsirtklqnkehviealrrakfkfpgrqkihiskkwgftkf

Timeline for d2pa2b1:

• d2pa2b1 first appeared in SCOP 1.75
  
• d2pa2b1 appears in SCOPe 2.03
  
• d2pa2b1 appears in SCOPe 2.05
  
• d2pa2b1 appears in the current release, SCOPe 2.08