Lineage for d2pa2b1 (2pa2 B:40-176)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2944850Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2945283Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families) (S)
  5. 2945284Family d.41.4.1: Ribosomal protein L10e [54687] (1 protein)
  6. 2945285Protein Ribosomal protein L10e [54688] (2 species)
  7. 2945345Species Human (Homo sapiens) [TaxId:9606] [160195] (1 PDB entry)
    Uniprot P27635 40-176
  8. 2945347Domain d2pa2b1: 2pa2 B:40-176 [149338]
    automatically matched to 2PA2 A:40-176
    complexed with k

    missing some secondary structures that made up less than one-third of the common domain

Details for d2pa2b1

PDB Entry: 2pa2 (more details), 2.5 Å

PDB Description: crystal structure of human ribosomal protein l10 core domain
PDB Compounds: (B:) 60S ribosomal protein L10

SCOPe Domain Sequences for d2pa2b1:

Sequence, based on SEQRES records: (download)

>d2pa2b1 d.41.4.1 (B:40-176) Ribosomal protein L10e {Human (Homo sapiens) [TaxId: 9606]}
kakvdefplcghmvsdeyeqlssealeaaricankymvkscgkdgfhirvrlhpfhviri
nkmlscagadrlqtgmrgafgkpqgtvarvhigqvimsirtklqnkehviealrrakfkf
pgrqkihiskkwgftkf

Sequence, based on observed residues (ATOM records): (download)

>d2pa2b1 d.41.4.1 (B:40-176) Ribosomal protein L10e {Human (Homo sapiens) [TaxId: 9606]}
kakvdefplcghmvsdeyeqlssealeaaricankymvkscgkdgfhirvrlhpfgtvar
vhigqvimsirtklqnkehviealrrakfkfpgrqkihiskkwgftkf

SCOPe Domain Coordinates for d2pa2b1:

Click to download the PDB-style file with coordinates for d2pa2b1.
(The format of our PDB-style files is described here.)

Timeline for d2pa2b1: