Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families) |
Family d.41.4.1: Ribosomal protein L10e [54687] (1 protein) |
Protein Ribosomal protein L10e [54688] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [160195] (1 PDB entry) Uniprot P27635 40-176 |
Domain d2pa2a1: 2pa2 A:40-176 [149337] core domain only complexed with k |
PDB Entry: 2pa2 (more details), 2.5 Å
SCOPe Domain Sequences for d2pa2a1:
Sequence, based on SEQRES records: (download)
>d2pa2a1 d.41.4.1 (A:40-176) Ribosomal protein L10e {Human (Homo sapiens) [TaxId: 9606]} kakvdefplcghmvsdeyeqlssealeaaricankymvkscgkdgfhirvrlhpfhviri nkmlscagadrlqtgmrgafgkpqgtvarvhigqvimsirtklqnkehviealrrakfkf pgrqkihiskkwgftkf
>d2pa2a1 d.41.4.1 (A:40-176) Ribosomal protein L10e {Human (Homo sapiens) [TaxId: 9606]} kakvdefplcghmvsdeyeqlssealeaaricankymvkscgkdgfhirvrlhpfgtvar vhigqvimsirtklqnkehviealrrakfkfpgrqkihiskkwgftkf
Timeline for d2pa2a1: