![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds) |
![]() | Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
![]() | Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (3 families) ![]() |
![]() | Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (18 proteins) |
![]() | Protein AMPC beta-Lactamase, class C [56618] (3 species) contains small alpha+beta subdomain inserted in the common fold |
![]() | Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (46 PDB entries) |
![]() | Domain d2p9vb1: 2p9v B:4-361 [149336] automatically matched to d1c3ba_ complexed with po4 |
PDB Entry: 2p9v (more details), 1.8 Å
SCOP Domain Sequences for d2p9vb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p9vb1 e.3.1.1 (B:4-361) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]} apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq
Timeline for d2p9vb1: