![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) ![]() the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
![]() | Family c.1.9.17: Imidazolonepropionase-like [159400] (3 proteins) automatically mapped to Pfam PF13147 |
![]() | Protein Uncharacterized protein BL1453 [159401] (1 species) Possible prolidase |
![]() | Species Bifidobacterium longum [TaxId:216816] [159402] (1 PDB entry) Uniprot Q8G4D5 69-392 |
![]() | Domain d2p9ba2: 2p9b A:71-394 [149334] Other proteins in same PDB: d2p9ba1 |
PDB Entry: 2p9b (more details), 1.7 Å
SCOPe Domain Sequences for d2p9ba2:
Sequence, based on SEQRES records: (download)
>d2p9ba2 c.1.9.17 (A:71-394) Uncharacterized protein BL1453 {Bifidobacterium longum [TaxId: 216816]} pglinahthlfsqgkplnpklatpkgqrmvatfahsplgkpymaatvkhnattllesgvt tirtlgdvgyevvtlrdqidagqilgprilasgplmaipeghgaplialtsgtpeearta vaqnlkagvnaikiaatggvtdaqeigeagspqmsveqmraicdeahqygvivgahaqsp egvrrsllagvdtiehgsvlddeligmfrhnpnalrgysaliptlsaglpltllgqdvtg itdiqlensknvvggmvsgarqaheaglmigvgtdtgmtfvpqyatwrelellvayagfs paealhaatavnasilgvdaetgs
>d2p9ba2 c.1.9.17 (A:71-394) Uncharacterized protein BL1453 {Bifidobacterium longum [TaxId: 216816]} pglinahthlfsymaatvkhnattllesgvttirtlgdvgyevvtlrdqidagqilgpri lasgplmaipeghgaplialtsgtpeeartavaqnlkagvnaikiaatggvtdaqeiqms veqmraicdeahqygvivgahaqspegvrrsllagvdtiehgsvlddeligmfrhnpnal rgysaliptlsaglpltllgqdvtgitdiqlensknvvggmvsgarqaheaglmigvgtd tgmtfvpqyatwrelellvayagfspaealhaatavnasilgvdaetgs
Timeline for d2p9ba2: