Lineage for d2p9ba2 (2p9b A:71-394)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2084338Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2084908Family c.1.9.17: Imidazolonepropionase-like [159400] (3 protein domains)
    automatically mapped to Pfam PF13147
  6. 2084924Protein Uncharacterized protein BL1453 [159401] (1 species)
    Possible prolidase
  7. 2084925Species Bifidobacterium longum [TaxId:216816] [159402] (1 PDB entry)
    Uniprot Q8G4D5 69-392
  8. 2084926Domain d2p9ba2: 2p9b A:71-394 [149334]
    Other proteins in same PDB: d2p9ba1

Details for d2p9ba2

PDB Entry: 2p9b (more details), 1.7 Å

PDB Description: Crystal structure of putative prolidase from Bifidobacterium longum
PDB Compounds: (A:) Possible prolidase

SCOPe Domain Sequences for d2p9ba2:

Sequence, based on SEQRES records: (download)

>d2p9ba2 c.1.9.17 (A:71-394) Uncharacterized protein BL1453 {Bifidobacterium longum [TaxId: 216816]}
pglinahthlfsqgkplnpklatpkgqrmvatfahsplgkpymaatvkhnattllesgvt
tirtlgdvgyevvtlrdqidagqilgprilasgplmaipeghgaplialtsgtpeearta
vaqnlkagvnaikiaatggvtdaqeigeagspqmsveqmraicdeahqygvivgahaqsp
egvrrsllagvdtiehgsvlddeligmfrhnpnalrgysaliptlsaglpltllgqdvtg
itdiqlensknvvggmvsgarqaheaglmigvgtdtgmtfvpqyatwrelellvayagfs
paealhaatavnasilgvdaetgs

Sequence, based on observed residues (ATOM records): (download)

>d2p9ba2 c.1.9.17 (A:71-394) Uncharacterized protein BL1453 {Bifidobacterium longum [TaxId: 216816]}
pglinahthlfsymaatvkhnattllesgvttirtlgdvgyevvtlrdqidagqilgpri
lasgplmaipeghgaplialtsgtpeeartavaqnlkagvnaikiaatggvtdaqeiqms
veqmraicdeahqygvivgahaqspegvrrsllagvdtiehgsvlddeligmfrhnpnal
rgysaliptlsaglpltllgqdvtgitdiqlensknvvggmvsgarqaheaglmigvgtd
tgmtfvpqyatwrelellvayagfspaealhaatavnasilgvdaetgs

SCOPe Domain Coordinates for d2p9ba2:

Click to download the PDB-style file with coordinates for d2p9ba2.
(The format of our PDB-style files is described here.)

Timeline for d2p9ba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2p9ba1