![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
![]() | Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) ![]() this domain is interrupted by the catalytic beta/alpha barrel domain |
![]() | Family b.92.1.10: Imidazolonepropionase-like [159347] (3 proteins) |
![]() | Protein Uncharacterized protein BL1453 [159353] (1 species) |
![]() | Species Bifidobacterium longum [TaxId:216816] [159354] (1 PDB entry) Uniprot Q8G4D5 7-68,393-448 |
![]() | Domain d2p9ba1: 2p9b A:9-70,A:395-450 [149333] Other proteins in same PDB: d2p9ba2 |
PDB Entry: 2p9b (more details), 1.7 Å
SCOPe Domain Sequences for d2p9ba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p9ba1 b.92.1.10 (A:9-70,A:395-450) Uncharacterized protein BL1453 {Bifidobacterium longum [TaxId: 216816]} pivepfalahativtgdkagtilrnmtivvgadgrieqvapsietsipaeyhyldgtgki vmXlevgksadllvlnanplddlralehpalviaaghpvwrpgpkrfadidalldeaya
Timeline for d2p9ba1: