Lineage for d2p9ba1 (2p9b A:9-70,A:395-450)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2819141Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 2819142Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 2819370Family b.92.1.10: Imidazolonepropionase-like [159347] (3 proteins)
  6. 2819386Protein Uncharacterized protein BL1453 [159353] (1 species)
  7. 2819387Species Bifidobacterium longum [TaxId:216816] [159354] (1 PDB entry)
    Uniprot Q8G4D5 7-68,393-448
  8. 2819388Domain d2p9ba1: 2p9b A:9-70,A:395-450 [149333]
    Other proteins in same PDB: d2p9ba2

Details for d2p9ba1

PDB Entry: 2p9b (more details), 1.7 Å

PDB Description: crystal structure of putative prolidase from bifidobacterium longum
PDB Compounds: (A:) Possible prolidase

SCOPe Domain Sequences for d2p9ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p9ba1 b.92.1.10 (A:9-70,A:395-450) Uncharacterized protein BL1453 {Bifidobacterium longum [TaxId: 216816]}
pivepfalahativtgdkagtilrnmtivvgadgrieqvapsietsipaeyhyldgtgki
vmXlevgksadllvlnanplddlralehpalviaaghpvwrpgpkrfadidalldeaya

SCOPe Domain Coordinates for d2p9ba1:

Click to download the PDB-style file with coordinates for d2p9ba1.
(The format of our PDB-style files is described here.)

Timeline for d2p9ba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2p9ba2