SCOPe 2.06: Domain d2p99a_: 2p99 A:

Lineage for d2p99a_ (2p99 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
   duplication: composed of two very similar alpha+beta folds

4. Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families)

5. Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)

6. Protein Methionine aminopeptidase [55924] (6 species)

7. Species Escherichia coli [TaxId:562] [55925] (32 PDB entries)
   Uniprot P07906

8. Domain d2p99a_: 2p99 A: [149331]
   automated match to d1c21a_
   complexed with mn, na, ye6

Details for d2p99a_

PDB Entry: 2p99, 1.8 Å

PDB Description: E. coli methionine aminopeptidase monometalated with inhibitor YE6

PDB Compounds: (A:) Methionine aminopeptidase

SCOPe Domain Sequences for d2p99a_:

Sequence; same for both SEQRES and ATOM records:

>d2p99a_ d.127.1.1 (A:) Methionine aminopeptidase {Escherichia coli [TaxId: 562]}
aisiktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclg
yhgypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptim
gerlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheep
qvlhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvt
dngceiltlrkddtipaiish

Timeline for d2p99a_:

• d2p99a_ first appeared in SCOP 1.75, called d2p99a1
  
• d2p99a_ appears in SCOPe 2.05
  
• d2p99a_ appears in SCOPe 2.07
  
• d2p99a_ appears in the current release, SCOPe 2.08