Lineage for d2p97a1 (2p97 A:1-200)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2997261Family d.157.1.12: Ava3068-like [160858] (1 protein)
  6. 2997262Protein Hypothetical protein Ava3068 [160859] (1 species)
  7. 2997263Species Anabaena variabilis [TaxId:1172] [160860] (1 PDB entry)
    Uniprot Q3M8K9 1-200
  8. 2997264Domain d2p97a1: 2p97 A:1-200 [149328]
    Other proteins in same PDB: d2p97a2, d2p97b3
    complexed with cl, mg

Details for d2p97a1

PDB Entry: 2p97 (more details), 1.65 Å

PDB Description: crystal structure of a putative metal-dependent hydrolase (ava_3068) from anabaena variabilis atcc 29413 at 1.65 a resolution
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2p97a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p97a1 d.157.1.12 (A:1-200) Hypothetical protein Ava3068 {Anabaena variabilis [TaxId: 1172]}
mkslhrpdlyswstfnparnidfngfawirpegnilidpvalsnhdwkhleslggvvwiv
ltnsdhvrsakeiadqtytkiagpvaekenfpiycdrwlsdgdelvpglkvmelqgsktp
gelallleettlitgdlvrayraggleilpdeklmnkqkvvasvrrlaalekveavlvgd
gwsvfrdgrdrlkelvatla

SCOPe Domain Coordinates for d2p97a1:

Click to download the PDB-style file with coordinates for d2p97a1.
(The format of our PDB-style files is described here.)

Timeline for d2p97a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2p97a2