![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
![]() | Superfamily c.56.8: Cgl1923-like [159659] (1 family) ![]() |
![]() | Family c.56.8.1: Cgl1923-like [159660] (1 protein) Pfam PF01908; DUF75 |
![]() | Protein Hypothetical protein Cgl1923 [159661] (1 species) |
![]() | Species Corynebacterium glutamicum [TaxId:1718] [159662] (1 PDB entry) Uniprot Q8NP93 6-274 |
![]() | Domain d2p90b1: 2p90 B:8-274 [149318] automatically matched to 2P90 A:6-274 |
PDB Entry: 2p90 (more details), 2.35 Å
SCOP Domain Sequences for d2p90b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p90b1 c.56.8.1 (B:8-274) Hypothetical protein Cgl1923 {Corynebacterium glutamicum [TaxId: 1718]} myeleypspevsgqtaggptlivalqgyadaghavesssshlmdaldhrliasfnndeli dyrsrrpvvviehnevtsmdelnlglhvvrdndnkpflmlsgpepdlrwgdfsnavvdlv ekfgventiclyaapmtvphtrptvvtahgnstdrlkdqvsldtrmtvpgsaslmlekll kdkgknvsgytvhvphyvsaspypaatlkllqsiadsadlnlpllalerdaekvhrqlme qteesseiqrvvgaleqqydseleryr
Timeline for d2p90b1: