| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.8: Cgl1923-like [159659] (1 family) ![]() automatically mapped to Pfam PF09754 |
| Family c.56.8.1: Cgl1923-like [159660] (1 protein) Pfam PF01908; DUF75 |
| Protein Hypothetical protein Cgl1923 [159661] (1 species) |
| Species Corynebacterium glutamicum [TaxId:1718] [159662] (1 PDB entry) Uniprot Q8NP93 6-274 |
| Domain d2p90b_: 2p90 B: [149318] automated match to d2p90a1 |
PDB Entry: 2p90 (more details), 2.35 Å
SCOPe Domain Sequences for d2p90b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p90b_ c.56.8.1 (B:) Hypothetical protein Cgl1923 {Corynebacterium glutamicum [TaxId: 1718]}
myeleypspevsgqtaggptlivalqgyadaghavesssshlmdaldhrliasfnndeli
dyrsrrpvvviehnevtsmdelnlglhvvrdndnkpflmlsgpepdlrwgdfsnavvdlv
ekfgventiclyaapmtvphtrptvvtahgnstdrlkdqvsldtrmtvpgsaslmlekll
kdkgknvsgytvhvphyvsaspypaatlkllqsiadsadlnlpllalerdaekvhrqlme
qteesseiqrvvgaleqqydseleryrnrhp
Timeline for d2p90b_: