Lineage for d2p90a1 (2p90 A:6-274)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 837609Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 838430Superfamily c.56.8: Cgl1923-like [159659] (1 family) (S)
  5. 838431Family c.56.8.1: Cgl1923-like [159660] (1 protein)
    Pfam PF01908; DUF75
  6. 838432Protein Hypothetical protein Cgl1923 [159661] (1 species)
  7. 838433Species Corynebacterium glutamicum [TaxId:1718] [159662] (1 PDB entry)
    Uniprot Q8NP93 6-274
  8. 838434Domain d2p90a1: 2p90 A:6-274 [149317]

Details for d2p90a1

PDB Entry: 2p90 (more details), 2.35 Å

PDB Description: The crystal structure of a protein of unknown function from Corynebacterium glutamicum ATCC 13032
PDB Compounds: (A:) Hypothetical protein Cgl1923

SCOP Domain Sequences for d2p90a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p90a1 c.56.8.1 (A:6-274) Hypothetical protein Cgl1923 {Corynebacterium glutamicum [TaxId: 1718]}
drmyeleypspevsgqtaggptlivalqgyadaghavesssshlmdaldhrliasfnnde
lidyrsrrpvvviehnevtsmdelnlglhvvrdndnkpflmlsgpepdlrwgdfsnavvd
lvekfgventiclyaapmtvphtrptvvtahgnstdrlkdqvsldtrmtvpgsaslmlek
llkdkgknvsgytvhvphyvsaspypaatlkllqsiadsadlnlpllalerdaekvhrql
meqteesseiqrvvgaleqqydseleryr

SCOP Domain Coordinates for d2p90a1:

Click to download the PDB-style file with coordinates for d2p90a1.
(The format of our PDB-style files is described here.)

Timeline for d2p90a1: