Lineage for d2p8ta2 (2p8t A:83-199)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1031575Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 1031791Superfamily d.74.4: GAD domain-like [55261] (2 families) (S)
  5. 1031815Family d.74.4.2: PH0730 C-terminal domain-like [160464] (1 protein)
  6. 1031816Protein Hypothetical protein PH0730 [160465] (1 species)
  7. 1031817Species Pyrococcus horikoshii [TaxId:53953] [160466] (1 PDB entry)
    Uniprot O58461 97-213
  8. 1031818Domain d2p8ta2: 2p8t A:83-199 [149316]
    Other proteins in same PDB: d2p8ta1

Details for d2p8ta2

PDB Entry: 2p8t (more details), 1.8 Å

PDB Description: hypothetical protein ph0730 from pyrococcus horikoshii ot3
PDB Compounds: (A:) Hypothetical protein PH0730

SCOPe Domain Sequences for d2p8ta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p8ta2 d.74.4.2 (A:83-199) Hypothetical protein PH0730 {Pyrococcus horikoshii [TaxId: 53953]}
mfsepigvsvdgypgiaivvknppefksielrdeaikfdakgamiltvkdneivfpedfr
plkemypevakkivdyedgdaviitwaetpakalksaihvayilkkeeitpeilevv

SCOPe Domain Coordinates for d2p8ta2:

Click to download the PDB-style file with coordinates for d2p8ta2.
(The format of our PDB-style files is described here.)

Timeline for d2p8ta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2p8ta1