SCOPe 2.08: Domain d2p8ta2: 2p8t A:83-199

Lineage for d2p8ta2 (2p8t A:83-199)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.74: DCoH-like [55247] (5 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.4: GAD domain-like [55261] (2 families)

5. Family d.74.4.2: PH0730 C-terminal domain-like [160464] (1 protein)

6. Protein Hypothetical protein PH0730 [160465] (1 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [160466] (1 PDB entry)
   Uniprot O58461 97-213

8. Domain d2p8ta2: 2p8t A:83-199 [149316]
   Other proteins in same PDB: d2p8ta1

Details for d2p8ta2

PDB Entry: 2p8t, 1.8 Å

PDB Description: hypothetical protein ph0730 from pyrococcus horikoshii ot3

PDB Compounds: (A:) Hypothetical protein PH0730

SCOPe Domain Sequences for d2p8ta2:

Sequence; same for both SEQRES and ATOM records:

>d2p8ta2 d.74.4.2 (A:83-199) Hypothetical protein PH0730 {Pyrococcus horikoshii [TaxId: 53953]}
mfsepigvsvdgypgiaivvknppefksielrdeaikfdakgamiltvkdneivfpedfr
plkemypevakkivdyedgdaviitwaetpakalksaihvayilkkeeitpeilevv

Timeline for d2p8ta2:

• d2p8ta2 first appeared in SCOP 1.75
  
• d2p8ta2 appears in SCOPe 2.07