Lineage for d2p8ta1 (2p8t A:14-82)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 905281Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 906051Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 907252Family a.4.5.72: PH0730 N-terminal domain-like [158302] (1 protein)
  6. 907253Protein Hypothetical protein PH0730 [158303] (1 species)
  7. 907254Species Pyrococcus horikoshii [TaxId:53953] [158304] (1 PDB entry)
    Uniprot O58461 28-96
  8. 907255Domain d2p8ta1: 2p8t A:14-82 [149315]
    Other proteins in same PDB: d2p8ta2

Details for d2p8ta1

PDB Entry: 2p8t (more details), 1.8 Å

PDB Description: hypothetical protein ph0730 from pyrococcus horikoshii ot3
PDB Compounds: (A:) Hypothetical protein PH0730

SCOPe Domain Sequences for d2p8ta1:

Sequence, based on SEQRES records: (download)

>d2p8ta1 a.4.5.72 (A:14-82) Hypothetical protein PH0730 {Pyrococcus horikoshii [TaxId: 53953]}
eytvedvlavifllkeplgrkqiserlelgegsvrtllrklshldiirskqrghfltlkg
keirdklls

Sequence, based on observed residues (ATOM records): (download)

>d2p8ta1 a.4.5.72 (A:14-82) Hypothetical protein PH0730 {Pyrococcus horikoshii [TaxId: 53953]}
eytvedvlavifllkeplgrkqiserlelgegsvrtllrklshldiirskghfltlkgke
irdklls

SCOPe Domain Coordinates for d2p8ta1:

Click to download the PDB-style file with coordinates for d2p8ta1.
(The format of our PDB-style files is described here.)

Timeline for d2p8ta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2p8ta2