Lineage for d2p8kd1 (2p8k D:5-288)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 819736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 820022Protein Dihydropteridin reductase (pteridine reductase) [51769] (6 species)
  7. 820025Species Leishmania major [TaxId:5664] [63926] (10 PDB entries)
    Uniprot Q01782
  8. 820067Domain d2p8kd1: 2p8k D:5-288 [149308]
    automatically matched to d1e7wa_
    complexed with dyp, nap

Details for d2p8kd1

PDB Entry: 2p8k (more details), 2.4 Å

PDB Description: Selective screening and design to identify inhibitors of Leishmania major pteridine reductase 1.
PDB Compounds: (D:) pteridine reductase 1

SCOP Domain Sequences for d2p8kd1:

Sequence, based on SEQRES records: (download)

>d2p8kd1 c.2.1.2 (D:5-288) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]}
tvpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqa
dlsnvatapvsgadgsapvtlftrcaelvaacythwgrcdvlvnnassfyptpllrnded
ghepcvgdreametatadlfgsnaiapyflikafahrvagtpakhrgtnysiinmvdamt
nqpllgytiytmakgalegltrsaalelaplqirvngvgpglsvlvddmppavweghrsk
vplyqrdssaaevsdvviflcsskakyitgtcvkvdggysltra

Sequence, based on observed residues (ATOM records): (download)

>d2p8kd1 c.2.1.2 (D:5-288) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]}
tvpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqa
dlsnvatapvapvtlftrcaelvaacythwgrcdvlvnnassfyptpllrreametatad
lfgsnaiapyflikafahrvagtpakhrgtnysiinmvdamtnqpllgytiytmakgale
gltrsaalelaplqirvngvgpglsvlvddmvweghrskvplyqrdssaaevsdvviflc
sskakyitgtcvkvdggysltra

SCOP Domain Coordinates for d2p8kd1:

Click to download the PDB-style file with coordinates for d2p8kd1.
(The format of our PDB-style files is described here.)

Timeline for d2p8kd1:

  • d2p8kd1 is new in SCOP 1.75
  • d2p8kd1 does not appear in SCOPe 2.01