SCOPe 2.08: Domain d2p84a1: 2p84 A:4-135

Lineage for d2p84a1 (2p84 A:4-135)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.172: YopX-like [159005] (1 superfamily)
   consists of two domains: the N-terminal dimerisation domain of variable structure and the C-terminal domain with similarity to the SH3-like fold

4. Superfamily b.172.1: YopX-like [159006] (2 families)
   conmrises proteins of plasmid and phage origins

5. Family b.172.1.1: YopX-like [159007] (3 proteins)
   Pfam PF09643

6. Protein Orf041 product [159012] (1 species)

7. Species Staphylococcus phage 37 [TaxId:320840] [159013] (1 PDB entry)
   Uniprot Q4ZC86 1-133

8. Domain d2p84a1: 2p84 A:4-135 [149304]
   Other proteins in same PDB: d2p84a2

Details for d2p84a1

PDB Entry: 2p84, 1.8 Å

PDB Description: crystal structure of orf041 from bacteriophage 37

PDB Compounds: (A:) orf041

SCOPe Domain Sequences for d2p84a1:

Sequence; same for both SEQRES and ATOM records:

>d2p84a1 b.172.1.1 (A:4-135) Orf041 product {Staphylococcus phage 37 [TaxId: 320840]}
ipkfrefdrerhrtdyqkgmsyaeqqdfdmgftiwfdhiedldliekdgtinrivmmstg
lkdknvkeiyesdivrnlygelyvvewldgsfvltefynggydhyiidssteyevlgniy
enpelleddnha

Timeline for d2p84a1:

• d2p84a1 first appeared in SCOP 1.75
  
• d2p84a1 appears in SCOPe 2.07