Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (22 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.22: Autophagin-like [159858] (2 proteins) Pfam PF03416 |
Protein Cysteine protease ATG4A [159859] (1 species) Autophagin-2 |
Species Human (Homo sapiens) [TaxId:9606] [159860] (1 PDB entry) Uniprot Q8WYN0 26-359 |
Domain d2p82d1: 2p82 D:26-357 [149303] automatically matched to 2P82 A:26-359 complexed with cl, edo |
PDB Entry: 2p82 (more details), 2.1 Å
SCOP Domain Sequences for d2p82d1:
Sequence, based on SEQRES records: (download)
>d2p82d1 d.3.1.22 (D:26-357) Cysteine protease ATG4A {Human (Homo sapiens) [TaxId: 9606]} delvwilgkqhllktekskllsdisarlwftyrrkfspiggtgpssdagwgcmlrcgqmm laqalicrhlgrdwswekqkeqpkeyqrilqcfldrkdccysihqmaqmgvgegksigew fgpntvaqvlkklalfdewnslavyvsmdntvviedikkmcrvlplsadtagdrppdslt asnqskgtsaycsawkplllivplrlginqinpvyvdafkecfkmpqslgalggkpnnay yfigflgdelifldphttqtfvdteengtvndqtfhclqspqrmnilnldpsvalgffck eekdfdnwcslvqkeilkenlrmfelvqkhps
>d2p82d1 d.3.1.22 (D:26-357) Cysteine protease ATG4A {Human (Homo sapiens) [TaxId: 9606]} delvwilgkqhllktekskllsdisarlwftyrrkfspiggtgpssdagwgcmlrcgqmm laqalicrhlgrdwswkeqpkeyqrilqcfldrkdccysihqmaqmgvgegksigewfgp ntvaqvlkklalfdewnslavyvsmdntvviedikkmcrvlpawkplllivplrlginqi npvyvdafkecfkmpqslgalggkpnnayyfigflgdelifldphttqtfvdteengtvn dqtfhclqspqrmnilnldpsvalgffckeekdfdnwcslvqkeilkenlrmfelvqkhp s
Timeline for d2p82d1: