Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (23 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.22: Autophagin-like [159858] (3 proteins) Pfam PF03416 |
Protein Cysteine protease ATG4A [159859] (1 species) Autophagin-2 |
Species Human (Homo sapiens) [TaxId:9606] [159860] (1 PDB entry) Uniprot Q8WYN0 26-359 |
Domain d2p82b_: 2p82 B: [149301] automated match to d2p82a1 complexed with cl, edo |
PDB Entry: 2p82 (more details), 2.1 Å
SCOPe Domain Sequences for d2p82b_:
Sequence, based on SEQRES records: (download)
>d2p82b_ d.3.1.22 (B:) Cysteine protease ATG4A {Human (Homo sapiens) [TaxId: 9606]} tdelvwilgkqhllktekskllsdisarlwftyrrkfspiggtgpssdagwgcmlrcgqm mlaqalicrhlgrdwswekqkeqpkeyqrilqcfldrkdccysihqmaqmgvgegksige wfgpntvaqvlkklalfdewnslavyvsmdntvviedikkmcrvlplsadtagdrppdsl tasnqskgtsaycsawkplllivplrlginqinpvyvdafkecfkmpqslgalggkpnna yyfigflgdelifldphttqtfvdteengtvndqtfhclqspqrmnilnldpsvalgffc keekdfdnwcslvqkeilkenlrmfelvqkhpshw
>d2p82b_ d.3.1.22 (B:) Cysteine protease ATG4A {Human (Homo sapiens) [TaxId: 9606]} tdelvwilgkqhllktekskllsdisarlwftyrrkfspiggtgpssdagwgcmlrcgqm mlaqalicrhlgrdwswekqkeqpkeyqrilqcfldrkdccysihqmaqmgvgegksige wfgpntvaqvlkklalfdewnslavyvsmdntvviedikkmcrvlplsacsawkpllliv plrlginqinpvyvdafkecfkmpqslgalggkpnnayyfigflgdelifldphttqtfv dteengtvndqtfhclqspqrmnilnldpsvalgffckeekdfdnwcslvqkeilkenlr mfelvqkhpshw
Timeline for d2p82b_: