Lineage for d2p82a1 (2p82 A:26-359)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2154577Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2154578Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2155379Family d.3.1.22: Autophagin-like [159858] (3 protein domains)
    Pfam PF03416
  6. 2155380Protein Cysteine protease ATG4A [159859] (1 species)
    Autophagin-2
  7. 2155381Species Human (Homo sapiens) [TaxId:9606] [159860] (1 PDB entry)
    Uniprot Q8WYN0 26-359
  8. 2155382Domain d2p82a1: 2p82 A:26-359 [149300]
    complexed with cl, edo

Details for d2p82a1

PDB Entry: 2p82 (more details), 2.1 Å

PDB Description: Cysteine protease ATG4A
PDB Compounds: (A:) Cysteine protease ATG4A

SCOPe Domain Sequences for d2p82a1:

Sequence, based on SEQRES records: (download)

>d2p82a1 d.3.1.22 (A:26-359) Cysteine protease ATG4A {Human (Homo sapiens) [TaxId: 9606]}
delvwilgkqhllktekskllsdisarlwftyrrkfspiggtgpssdagwgcmlrcgqmm
laqalicrhlgrdwswekqkeqpkeyqrilqcfldrkdccysihqmaqmgvgegksigew
fgpntvaqvlkklalfdewnslavyvsmdntvviedikkmcrvlplsadtagdrppdslt
asnqskgtsaycsawkplllivplrlginqinpvyvdafkecfkmpqslgalggkpnnay
yfigflgdelifldphttqtfvdteengtvndqtfhclqspqrmnilnldpsvalgffck
eekdfdnwcslvqkeilkenlrmfelvqkhpshw

Sequence, based on observed residues (ATOM records): (download)

>d2p82a1 d.3.1.22 (A:26-359) Cysteine protease ATG4A {Human (Homo sapiens) [TaxId: 9606]}
delvwilgkqhllktekskllsdisarlwftyrrkfspiggtgpssdagwgcmlrcgqmm
laqalicrhlgrdwswekqkeqpkeyqrilqcfldrkdccysihqmaqmgvgegksigew
fgpntvaqvlkklalfdewnslavyvsmdntvviedikkmcrvlplsaycsawkpllliv
plrlginqinpvyvdafkecfkmpqslgalggkpnnayyfigflgdelifldphttqtfv
dteengtvndqtfhclqspqrmnilnldpsvalgffckeekdfdnwcslvqkeilkenlr
mfelvqkhpshw

SCOPe Domain Coordinates for d2p82a1:

Click to download the PDB-style file with coordinates for d2p82a1.
(The format of our PDB-style files is described here.)

Timeline for d2p82a1: