Lineage for d2p80d_ (2p80 D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2770400Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2770922Protein Pseudoazurin [49522] (4 species)
  7. 2770950Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49523] (14 PDB entries)
    Uniprot P04377
  8. 2770964Domain d2p80d_: 2p80 D: [149299]
    Other proteins in same PDB: d2p80a1, d2p80a2, d2p80b1, d2p80b2, d2p80c1, d2p80c2
    automated match to d8paza_
    complexed with cu, gd

Details for d2p80d_

PDB Entry: 2p80 (more details)

PDB Description: solution structure of the complex between nitrite reductase and pseudoazurin from a. faecalis
PDB Compounds: (D:) pseudoazurin

SCOPe Domain Sequences for d2p80d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p80d_ b.6.1.1 (D:) Pseudoazurin {Alcaligenes faecalis, strain s-6 [TaxId: 511]}
enievhmlnkgaegamvfepayikanpgdtvtfipvdkghnvesikdmipegaekfkski
nenyvltvtqpgaylvkctphyamgmialiavgdspanldqivsakkpkivqerlekvia
sak

SCOPe Domain Coordinates for d2p80d_:

Click to download the PDB-style file with coordinates for d2p80d_.
(The format of our PDB-style files is described here.)

Timeline for d2p80d_: