Lineage for d2p80c1 (2p80 C:4-161)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2772201Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2772202Protein automated matches [190824] (31 species)
    not a true protein
  7. 2772230Species Alcaligenes faecalis [TaxId:511] [226762] (16 PDB entries)
  8. 2772321Domain d2p80c1: 2p80 C:4-161 [149297]
    Other proteins in same PDB: d2p80d_
    automated match to d3h4fa1
    complexed with cu, gd

Details for d2p80c1

PDB Entry: 2p80 (more details)

PDB Description: solution structure of the complex between nitrite reductase and pseudoazurin from a. faecalis
PDB Compounds: (C:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d2p80c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p80c1 b.6.1.0 (C:4-161) automated matches {Alcaligenes faecalis [TaxId: 511]}
ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama
fngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilr
fkatkpgvfvyhcappgmvpwhvvsgmngaimvlpreg

SCOPe Domain Coordinates for d2p80c1:

Click to download the PDB-style file with coordinates for d2p80c1.
(The format of our PDB-style files is described here.)

Timeline for d2p80c1: