![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
![]() | Protein automated matches [190824] (31 species) not a true protein |
![]() | Species Alcaligenes faecalis [TaxId:511] [226762] (16 PDB entries) |
![]() | Domain d2p80c1: 2p80 C:4-161 [149297] Other proteins in same PDB: d2p80d_ automated match to d3h4fa1 complexed with cu, gd |
PDB Entry: 2p80 (more details)
SCOPe Domain Sequences for d2p80c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p80c1 b.6.1.0 (C:4-161) automated matches {Alcaligenes faecalis [TaxId: 511]} ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama fngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilr fkatkpgvfvyhcappgmvpwhvvsgmngaimvlpreg
Timeline for d2p80c1: