SCOP 1.75: Domain d2p80a2: 2p80 A:167-337

Lineage for d2p80a2 (2p80 A:167-337)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (7 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)

6. Protein Nitrite reductase, NIR [49551] (5 species)
   consists of two domains of this fold

7. Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (33 PDB entries)
   Uniprot P38501

8. Domain d2p80a2: 2p80 A:167-337 [149294]
   Other proteins in same PDB: d2p80d1
   automatically matched to d1ndra2
   complexed with cu, gd

Details for d2p80a2

PDB Entry: 2p80

PDB Description: solution structure of the complex between nitrite reductase and pseudoazurin from a. faecalis

PDB Compounds: (A:) Copper-containing nitrite reductase

SCOP Domain Sequences for d2p80a2:

Sequence; same for both SEQRES and ATOM records:

>d2p80a2 b.6.1.3 (A:167-337) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6 [TaxId: 511]}
gkaltydkiyyvgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavga
ltgdkamtaavgekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipgg
aagaafytfqqpgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlap

Timeline for d2p80a2:

• d2p80a2 is new in SCOP 1.75
  
• d2p80a2 appears in SCOPe 2.01
  
• d2p80a2 appears in the current release, SCOPe 2.08