![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.14: Gated ion channels [81325] (2 superfamilies) oligomeric transmembrane alpha-helical proteins |
![]() | Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) ![]() Pfam PF00520 |
![]() | Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
![]() | Protein Potassium channel protein [56901] (3 species) |
![]() | Species Streptomyces lividans [TaxId:1916] [161074] (28 PDB entries) |
![]() | Domain d2p7tc_: 2p7t C: [149291] Other proteins in same PDB: d2p7ta1, d2p7ta2, d2p7ta3, d2p7tb1, d2p7tb2 automated match to d1k4cc_ complexed with 1em, f09, k; mutant |
PDB Entry: 2p7t (more details), 2.05 Å
SCOPe Domain Sequences for d2p7tc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p7tc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces lividans [TaxId: 1916]} salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvstattvgygdl ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh
Timeline for d2p7tc_: