SCOPe 2.01: Domain d2p7tc_: 2p7t C:

Lineage for d2p7tc_ (2p7t C:)

1. Root: SCOPe 2.01

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family)

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)

6. Protein Potassium channel protein [56901] (2 species)

7. Species Streptomyces coelicolor [TaxId:1902] [56902] (26 PDB entries)
   identical sequence to Streptomyces lividans, TaxId: 1916
   Uniprot Q54397 22-124

8. Domain d2p7tc_: 2p7t C: [149291]
   automated match to d1k4cc_
   complexed with 1em, f09, k; mutant

Details for d2p7tc_

PDB Entry: 2p7t, 2.05 Å

PDB Description: crystal structure of kcsa mutant

PDB Compounds: (C:) Voltage-gated potassium channel

SCOPe Domain Sequences for d2p7tc_:

Sequence; same for both SEQRES and ATOM records:

>d2p7tc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvstattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh

Timeline for d2p7tc_:

• d2p7tc_ first appeared in SCOP 1.75, called d2p7tc1
  
• d2p7tc_ appears in SCOPe 2.02
  
• d2p7tc_ appears in the current release, SCOPe 2.08, called d2p7tc2