Lineage for d2p7tc1 (2p7t C:86-119)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 886689Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
    oligomeric transmembrane alpha-helical proteins
  4. 886690Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family) (S)
  5. 886691Family f.14.1.1: Voltage-gated potassium channels [81323] (5 proteins)
  6. 886708Protein Potassium channel protein [56901] (2 species)
  7. 886762Species Streptomyces lividans [TaxId:1916] [161074] (2 PDB entries)
  8. 886763Domain d2p7tc1: 2p7t C:86-119 [149291]
    automatically matched to d1jq1a_
    complexed with 1em, f09, k; mutant

Details for d2p7tc1

PDB Entry: 2p7t (more details), 2.05 Å

PDB Description: crystal structure of kcsa mutant
PDB Compounds: (C:) Voltage-gated potassium channel

SCOP Domain Sequences for d2p7tc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p7tc1 f.14.1.1 (C:86-119) Potassium channel protein {Streptomyces lividans [TaxId: 1916]}
lwgrcvavvvmvagitsfglvtaalatwfvgreq

SCOP Domain Coordinates for d2p7tc1:

Click to download the PDB-style file with coordinates for d2p7tc1.
(The format of our PDB-style files is described here.)

Timeline for d2p7tc1: