SCOP 1.75: Domain d2p7ib1: 2p7i B:21-249

Lineage for d2p7ib1 (2p7i B:21-249)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (57 families)

5. Family c.66.1.41: UbiE/COQ5-like [110671] (5 proteins)
   Pfam PF01209

6. Protein Hypothetical protein ECA1738 [159682] (1 species)

7. Species Erwinia carotovora [TaxId:554] [159683] (2 PDB entries)
   Uniprot Q6D6E7 21-249

8. Domain d2p7ib1: 2p7i B:21-249 [149286]
   automatically matched to 2P7H A:21-249
   complexed with cl, mpd, na, trs

Details for d2p7ib1

PDB Entry: 2p7i, 1.74 Å

PDB Description: crystal structure of a sam dependent methyl-transferase type 12 family protein (eca1738) from pectobacterium atrosepticum scri1043 at 1.74 a resolution

PDB Compounds: (B:) hypothetical protein

SCOP Domain Sequences for d2p7ib1:

Sequence; same for both SEQRES and ATOM records:

>d2p7ib1 c.66.1.41 (B:21-249) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]}
ynfdfdvmhpfmvraftpffrpgnllelgsfkgdftsrlqehfnditcveaseeaishaq
grlkdgityihsrfedaqlprrydnivlthvlehiddpvallkrinddwlaeggrlflvc
pnanavsrqiavkmgiishnsavteaefahghrctyaldtlerdasraglqvtyrsgiff
kalanfqwdqilqtdilskeyldgcyqlgqqypdlcasifllcekginq

Timeline for d2p7ib1:

• d2p7ib1 is new in SCOP 1.75
  
• d2p7ib1 appears in SCOPe 2.01
  
• d2p7ib1 appears in the current release, SCOPe 2.08, called d2p7ib_