Lineage for d2p6va1 (2p6v A:582-678)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2738960Fold a.277: TAFH domain-like [158552] (1 superfamily)
    5 helices; folded leaf, closed
  4. 2738961Superfamily a.277.1: TAFH domain-like [158553] (1 family) (S)
    automatically mapped to Pfam PF07531
  5. 2738962Family a.277.1.1: TAFH domain-like [158554] (2 proteins)
    Pfam PF07531
  6. 2738968Protein Transcription initiation factor TFIID subunit 4, TAF4 [158555] (1 species)
  7. 2738969Species Human (Homo sapiens) [TaxId:9606] [158556] (1 PDB entry)
    Uniprot O00268 583-679
  8. 2738970Domain d2p6va1: 2p6v A:582-678 [149278]
    complexed with so4

Details for d2p6va1

PDB Entry: 2p6v (more details), 2 Å

PDB Description: Structure of TAFH domain of the human TAF4 subunit of TFIID
PDB Compounds: (A:) Transcription initiation factor TFIID subunit 4

SCOPe Domain Sequences for d2p6va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p6va1 a.277.1.1 (A:582-678) Transcription initiation factor TFIID subunit 4, TAF4 {Human (Homo sapiens) [TaxId: 9606]}
ssaatetmenvkkcknflstliklassgkqstetaanvkelvqnlldgkieaedftsrly
relnsspqpylvpflkrslpalrqltpdsaafiqqsq

SCOPe Domain Coordinates for d2p6va1:

Click to download the PDB-style file with coordinates for d2p6va1.
(The format of our PDB-style files is described here.)

Timeline for d2p6va1: