Lineage for d2p6ua4 (2p6u A:203-403)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479613Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2479614Protein automated matches [190123] (156 species)
    not a true protein
  7. 2479675Species Archaeoglobus fulgidus [TaxId:2234] [187684] (2 PDB entries)
  8. 2479679Domain d2p6ua4: 2p6u A:203-403 [149277]
    Other proteins in same PDB: d2p6ua1, d2p6ua2
    automated match to d2p6ra4
    complexed with po4

Details for d2p6ua4

PDB Entry: 2p6u (more details), 3.14 Å

PDB Description: Apo structure of the Hel308 superfamily 2 helicase
PDB Compounds: (A:) afUHEL308 HELICASE

SCOPe Domain Sequences for d2p6ua4:

Sequence, based on SEQRES records: (download)

>d2p6ua4 c.37.1.0 (A:203-403) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
pvplvegvlcegtlelfdgafstsrrvkfeelveecvaenggvlvfestrrgaektavkl
saitakyveneglekaileenegemsrklaecvrkgaafhhagllngqrrvvedafrrgn
ikvvvatptlaagvnlparrvivrslyrfdgyskrikvseykqmagragrpgmdergeai
iivgkrdreiavkryifgepe

Sequence, based on observed residues (ATOM records): (download)

>d2p6ua4 c.37.1.0 (A:203-403) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
pvplvegvlcegtlelfdgafstsrrvkfeelveecvaenggvlvfestrrgaektavkl
saitakyveneglekaileenegemsrklaecvrkgaafhhagllngqrrvvedafrrgn
ikvvvatptlvnlparrvivrslyrfkrikvseykqmagragrpgmdergeaiiivgkrd
reiavkryifgepe

SCOPe Domain Coordinates for d2p6ua4:

Click to download the PDB-style file with coordinates for d2p6ua4.
(The format of our PDB-style files is described here.)

Timeline for d2p6ua4: