SCOPe 2.08: Domain d2p6ua3: 2p6u A:1-202

Lineage for d2p6ua3 (2p6u A:1-202)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Archaeoglobus fulgidus [TaxId:2234] [187684] (2 PDB entries)

8. Domain d2p6ua3: 2p6u A:1-202 [149276]
   Other proteins in same PDB: d2p6ua1, d2p6ua2
   automated match to d2p6ra3
   complexed with po4

Details for d2p6ua3

PDB Entry: 2p6u, 3.14 Å

PDB Description: Apo structure of the Hel308 superfamily 2 helicase

PDB Compounds: (A:) afUHEL308 HELICASE

SCOPe Domain Sequences for d2p6ua3:

Sequence, based on SEQRES records:

>d2p6ua3 c.37.1.0 (A:1-202) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
mkveelaesissyavgilkeegieelfppqaeavekvfsgknlllamptaagktllaema
mvreaikggkslyvvplralagekyesfkkwekiglrigistgdyesrdehlgdcdiivt
tsekadslirnraswikavsclvvdeihlldsekrgatleilvtkmrrmnkalrviglsa
tapnvteiaewldadyyvsdwr

Sequence, based on observed residues (ATOM records):

>d2p6ua3 c.37.1.0 (A:1-202) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
mkveelaesissyavgilfppqaeavekvfsgknlllamptaagktllaemamvreaikg
gkslyvvplralagekyesfkkwekiglrigistgdyesrdehlgdcdiivttsekadsl
irnraswikavsclvvdeihlldsekrgatleilvtkmrrmnkalrviglsatapnvtei
aewldadyyvsdwr

Timeline for d2p6ua3:

• d2p6ua3 first appeared in SCOP 1.75
  
• d2p6ua3 appears in SCOPe 2.07