SCOP 1.75: Domain d2p6ua2: 2p6u A:489-686

Lineage for d2p6ua2 (2p6u A:489-686)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.289: Sec63 N-terminal domain-like [158701] (1 superfamily)
   multihelical; consists of two helical subdomains

4. Superfamily a.289.1: Sec63 N-terminal domain-like [158702] (2 families)

5. Family a.289.1.2: Achaeal helicase C-terminal domain [158706] (1 protein)

6. Protein Hel308 helicase [158707] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [158708] (2 PDB entries)

8. Domain d2p6ua2: 2p6u A:489-686 [149275]
   Other proteins in same PDB: d2p6ua1, d2p6ua3, d2p6ua4
   automatically matched to 2P6R A:489-686
   complexed with po4

Details for d2p6ua2

PDB Entry: 2p6u, 3.14 Å

PDB Description: Apo structure of the Hel308 superfamily 2 helicase

PDB Compounds: (A:) afUHEL308 HELICASE

SCOP Domain Sequences for d2p6ua2:

Sequence; same for both SEQRES and ATOM records:

>d2p6ua2 a.289.1.2 (A:489-686) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]}
dpltgfifhdvlsrmelsdigalhlicrtpdmerltvrktdswveeeafrlrkelsyyps
dfsveydwflsevktalclkdwieekdedeicakygiapgdlrrivetaewlsnamnria
eevgntsvsglterikhgvkeellelvrirhigrvrarklynagirnaedivrhrekvas
ligrgiaervvegisvks

Timeline for d2p6ua2:

• d2p6ua2 is new in SCOP 1.75
  
• d2p6ua2 appears in SCOPe 2.01
  
• d2p6ua2 appears in the current release, SCOPe 2.08