Lineage for d2p6ua2 (2p6u A:489-686)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2739248Fold a.289: Sec63 N-terminal domain-like [158701] (1 superfamily)
    multihelical; consists of two helical subdomains
  4. 2739249Superfamily a.289.1: Sec63 N-terminal domain-like [158702] (4 families) (S)
  5. 2739265Family a.289.1.0: automated matches [254268] (1 protein)
    not a true family
  6. 2739266Protein automated matches [254621] (2 species)
    not a true protein
  7. Species Archaeoglobus fulgidus [TaxId:2234] [255542] (1 PDB entry)
  8. 2739268Domain d2p6ua2: 2p6u A:489-686 [149275]
    Other proteins in same PDB: d2p6ua1, d2p6ua3, d2p6ua4
    automated match to d2p6ra2
    complexed with po4

Details for d2p6ua2

PDB Entry: 2p6u (more details), 3.14 Å

PDB Description: Apo structure of the Hel308 superfamily 2 helicase
PDB Compounds: (A:) afUHEL308 HELICASE

SCOPe Domain Sequences for d2p6ua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p6ua2 a.289.1.0 (A:489-686) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
dpltgfifhdvlsrmelsdigalhlicrtpdmerltvrktdswveeeafrlrkelsyyps
dfsveydwflsevktalclkdwieekdedeicakygiapgdlrrivetaewlsnamnria
eevgntsvsglterikhgvkeellelvrirhigrvrarklynagirnaedivrhrekvas
ligrgiaervvegisvks

SCOPe Domain Coordinates for d2p6ua2:

Click to download the PDB-style file with coordinates for d2p6ua2.
(The format of our PDB-style files is described here.)

Timeline for d2p6ua2: