Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (92 species) not a true protein |
Domain d2p6ua1: 2p6u A:404-488 [149274] Other proteins in same PDB: d2p6ua2, d2p6ua3, d2p6ua4 automated match to d2p6ra1 complexed with po4 |
PDB Entry: 2p6u (more details), 3.14 Å
SCOPe Domain Sequences for d2p6ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p6ua1 a.4.5.0 (A:404-488) automated matches {Archaeoglobus fulgidus [TaxId: 2234]} ritsklgvethlrfhslsiicdgyaktleeledffadtfffkqneislsyelervvrqle nwgmvveaahlaptklgslvsrlyi
Timeline for d2p6ua1: