Lineage for d2p6ra4 (2p6r A:203-403)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 831899Family c.37.1.19: Tandem AAA-ATPase domain [81268] (23 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 831958Protein Hel308 helicase [159575] (1 species)
  7. 831959Species Archaeoglobus fulgidus [TaxId:2234] [159576] (2 PDB entries)
  8. 831961Domain d2p6ra4: 2p6r A:203-403 [149273]
    Other proteins in same PDB: d2p6ra1, d2p6ra2

Details for d2p6ra4

PDB Entry: 2p6r (more details), 3 Å

PDB Description: Crystal structure of superfamily 2 helicase Hel308 in complex with unwound DNA
PDB Compounds: (A:) afUHEL308 HELICASE

SCOP Domain Sequences for d2p6ra4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]}
pvplvegvlcegtlelfdgafstsrrvkfeelveecvaenggvlvfestrrgaektavkl
saitakyveneglekaileenegemsrklaecvrkgaafhhagllngqrrvvedafrrgn
ikvvvatptlaagvnlparrvivrslyrfdgyskrikvseykqmagragrpgmdergeai
iivgkrdreiavkryifgepe

SCOP Domain Coordinates for d2p6ra4:

Click to download the PDB-style file with coordinates for d2p6ra4.
(The format of our PDB-style files is described here.)

Timeline for d2p6ra4: