Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.43: RecQ helicase DNA-binding domain-like [101030] (3 proteins) follows the tandem AAA-ATPase domain |
Protein Hel308 helicase [158286] (1 species) |
Species Archaeoglobus fulgidus [TaxId:2234] [158287] (1 PDB entry) |
Domain d2p6ra1: 2p6r A:404-488 [149270] Other proteins in same PDB: d2p6ra2, d2p6ra3, d2p6ra4 protein/DNA complex |
PDB Entry: 2p6r (more details), 3 Å
SCOPe Domain Sequences for d2p6ra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p6ra1 a.4.5.43 (A:404-488) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} ritsklgvethlrfhslsiicdgyaktleeledffadtfffkqneislsyelervvrqle nwgmvveaahlaptklgslvsrlyi
Timeline for d2p6ra1: