SCOPe 2.06: Domain d2p6ra1: 2p6r A:404-488

Lineage for d2p6ra1 (2p6r A:404-488)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.43: RecQ helicase DNA-binding domain-like [101030] (3 proteins)
   follows the tandem AAA-ATPase domain

6. Protein Hel308 helicase [158286] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [158287] (1 PDB entry)

8. Domain d2p6ra1: 2p6r A:404-488 [149270]
   Other proteins in same PDB: d2p6ra2, d2p6ra3, d2p6ra4
   protein/DNA complex

Details for d2p6ra1

PDB Entry: 2p6r, 3 Å

PDB Description: Crystal structure of superfamily 2 helicase Hel308 in complex with unwound DNA

PDB Compounds: (A:) afUHEL308 HELICASE

SCOPe Domain Sequences for d2p6ra1:

Sequence; same for both SEQRES and ATOM records:

>d2p6ra1 a.4.5.43 (A:404-488) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]}
ritsklgvethlrfhslsiicdgyaktleeledffadtfffkqneislsyelervvrqle
nwgmvveaahlaptklgslvsrlyi

Timeline for d2p6ra1:

• d2p6ra1 first appeared in SCOP 1.75
  
• d2p6ra1 appears in SCOPe 2.05
  
• d2p6ra1 appears in SCOPe 2.07
  
• d2p6ra1 appears in the current release, SCOPe 2.08