Lineage for d2p67a1 (2p67 A:2-327)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2111791Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 protein domains)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2111981Protein LAO/AO transport system kinase ArgK [159562] (1 species)
    member of Pfam PF03308; contains extra N-terminal 3-helical bundle and extra C-terminal helical dimerisation domain
  7. 2111982Species Escherichia coli [TaxId:562] [159563] (1 PDB entry)
    Uniprot P27254 1-327
  8. 2111983Domain d2p67a1: 2p67 A:2-327 [149269]
    Other proteins in same PDB: d2p67a2
    complexed with cl, na

Details for d2p67a1

PDB Entry: 2p67 (more details), 1.8 Å

PDB Description: crystal structure of lao/ao transport system kinase
PDB Compounds: (A:) LAO/AO transport system kinase

SCOPe Domain Sequences for d2p67a1:

Sequence, based on SEQRES records: (download)

>d2p67a1 c.37.1.10 (A:2-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]}
ineatlaesirrlrqgeratlaqamtlvesrhprhqalstqlldaimpycgntlrlgvtg
tpgagkstfleafgmllireglkvaviavdpsspvtggsilgdktrmndlaraeaafirp
vpssghlggasqrarelmllceaagydvvivetvgvgqsetevarmvdcfislqiagggd
dlqgikkglmevadlivinkddgdnhtnvaiarhmyesalhilrrkydewqprvltcsal
ekrgideiwhaiidfktaltasgrlqqvrqqqsvewlrkqteeevlnhlfanedfdryyr
qtllavknntlsprtglrqlsefiqt

Sequence, based on observed residues (ATOM records): (download)

>d2p67a1 c.37.1.10 (A:2-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]}
ineatlaesirrlrqgeratlaqamtlvesrhprhqalstqlldaimpycgntlrlgvtg
tpgagkstfleafgmllireglkvaviavdpsndlaraeaafirpvpsgasqrarelmll
ceaagydvvivetvgvgqsetevarmvdcfislqiaqgikkglmevadlivinkddgdnh
tnvaiarhmyesalhilrrkydewqprvltcsalekrgideiwhaiidfktaltasgrlq
qvrqqqsvewlrkqteeevlnhlfanedfdryyrqtllavknntlsprtglrqlsefiqt

SCOPe Domain Coordinates for d2p67a1:

Click to download the PDB-style file with coordinates for d2p67a1.
(The format of our PDB-style files is described here.)

Timeline for d2p67a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2p67a2