SCOPe 2.08: Domain d2p5zx3: 2p5z X:202-377

Lineage for d2p5zx3 (2p5z X:202-377)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.106: Phage tail proteins [69278] (1 superfamily)
   core: barrel; n=6, S=10; greek-key; topologically similar to the FMN-binding split barrel

4. Superfamily b.106.1: Phage tail proteins [69279] (4 families)

5. Family b.106.1.1: Baseplate protein-like [69280] (4 proteins)
   duplication: consists of two similar barrel domains that differ by the first strand directions; the barrels are differently decorated by alpha+beta insertions

6. Protein Hypothetical protein c3393 [159177] (1 species)
   probable phage-related protein; similar to fusion of the T4 phage gp27 and (a part of) gp5

7. Species Escherichia coli o6 [TaxId:217992] [159178] (1 PDB entry)
   Uniprot Q8FED2 15-201! Uniprot Q8FED2 202-377

8. Domain d2p5zx3: 2p5z X:202-377 [149265]
   Other proteins in same PDB: d2p5zx1
   fragment; missing more than one-third of the common structure and/or sequence

Details for d2p5zx3

PDB Entry: 2p5z, 2.6 Å

PDB Description: the e. coli c3393 protein is a component of the type vi secretion system and exhibits structural similarity to t4 bacteriophage tail proteins gp27 and gp5

PDB Compounds: (X:) Type VI secretion system component

SCOPe Domain Sequences for d2p5zx3:

Sequence, based on SEQRES records:

>d2p5zx3 b.106.1.1 (X:202-377) Hypothetical protein c3393 {Escherichia coli o6 [TaxId: 217992]}
dqsgyergltlplrhpsglfdgeteavwglntaysvveksvstrdynyreataemttgqh
datggdnttygeayhyadnflqqgdkeaaesgafyarirherylneqailkgqstssllm
pgleikvqgddapavfrkgvlitgvttsaardrsyeltftaipyserygyrpalip

Sequence, based on observed residues (ATOM records):

>d2p5zx3 b.106.1.1 (X:202-377) Hypothetical protein c3393 {Escherichia coli o6 [TaxId: 217992]}
dqsgyergltlplrteavwglntaysvsgafyarirherylneqailkgqstssllmpgl
eikvqgddapavfrkgvlitgvttsaardrsyeltftaipyserygyrpalip

Timeline for d2p5zx3:

• d2p5zx3 first appeared in SCOP 1.75
  
• d2p5zx3 appears in SCOPe 2.07