SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2p5zx3 (2p5z X:202-377)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2074918Fold b.106: Phage tail proteins [69278] (1 superfamily)
    core: barrel; n=6, S=10; greek-key; topologically similar to the FMN-binding split barrel
  4. 2074919Superfamily b.106.1: Phage tail proteins [69279] (3 families) (S)
  5. 2074920Family b.106.1.1: Baseplate protein-like [69280] (3 protein domains)
    duplication: consists of two similar barrel domains that differ by the first strand directions; the barrels are differently decorated by alpha+beta insertions
  6. 2074951Protein Hypothetical protein c3393 [159177] (1 species)
    probable phage-related protein; similar to fusion of the T4 phage gp27 and (a part of) gp5
  7. 2074952Species Escherichia coli o6 [TaxId:217992] [159178] (1 PDB entry)
    Uniprot Q8FED2 15-201! Uniprot Q8FED2 202-377
  8. 2074954Domain d2p5zx3: 2p5z X:202-377 [149265]
    Other proteins in same PDB: d2p5zx1

Details for d2p5zx3

PDB Entry: 2p5z (more details), 2.6 Å

PDB Description: The E. coli c3393 protein is a component of the type VI secretion system and exhibits structural similarity to T4 bacteriophage tail proteins gp27 and gp5
PDB Compounds: (X:) Type VI secretion system component

SCOPe Domain Sequences for d2p5zx3:

Sequence, based on SEQRES records: (download)

>d2p5zx3 b.106.1.1 (X:202-377) Hypothetical protein c3393 {Escherichia coli o6 [TaxId: 217992]}
dqsgyergltlplrhpsglfdgeteavwglntaysvveksvstrdynyreataemttgqh
datggdnttygeayhyadnflqqgdkeaaesgafyarirherylneqailkgqstssllm
pgleikvqgddapavfrkgvlitgvttsaardrsyeltftaipyserygyrpalip

Sequence, based on observed residues (ATOM records): (download)

>d2p5zx3 b.106.1.1 (X:202-377) Hypothetical protein c3393 {Escherichia coli o6 [TaxId: 217992]}
dqsgyergltlplrteavwglntaysvsgafyarirherylneqailkgqstssllmpgl
eikvqgddapavfrkgvlitgvttsaardrsyeltftaipyserygyrpalip

SCOPe Domain Coordinates for d2p5zx3:

Click to download the PDB-style file with coordinates for d2p5zx3.
(The format of our PDB-style files is described here.)

Timeline for d2p5zx3: