SCOPe 2.08: Domain d2p5wb2: 2p5w B:1-99

Lineage for d2p5wb2 (2p5w B:1-99)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88602] (480 PDB entries)
   Uniprot P61769 21-119 ! Uniprot P01884

8. Domain d2p5wb2: 2p5w B:1-99 [149262]
   Other proteins in same PDB: d2p5wa1, d2p5wa2, d2p5wb3
   automated match to d1a9bb_
   complexed with ca, epe, gol, mg, so4

Details for d2p5wb2

PDB Entry: 2p5w, 2.2 Å

PDB Description: Crystal structures of high affinity human T-cell receptors bound to pMHC reveal native diagonal binding geometry

PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d2p5wb2:

Sequence; same for both SEQRES and ATOM records:

>d2p5wb2 b.1.1.2 (B:1-99) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]}
iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw
sfyllyyteftptekdeyacrvnhvtlsqpcivkwdrdm

Timeline for d2p5wb2:

• d2p5wb2 first appeared in SCOP 1.75, called d2p5wb1
  
• d2p5wb2 appears in SCOPe 2.07