Lineage for d2p5pc1 (2p5p C:300-400)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788950Superfamily b.1.18: E set domains [81296] (23 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 789318Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (2 proteins)
  6. 789319Protein Envelope glycoprotein [49213] (5 species)
  7. 789352Species West Nile virus [TaxId:11082] [110056] (3 PDB entries)
    Uniprot Q8JU42 586-696
  8. 789356Domain d2p5pc1: 2p5p C:300-400 [149259]
    automatically matched to d1s6na_

Details for d2p5pc1

PDB Entry: 2p5p (more details), 2.8 Å

PDB Description: Crystal Structure Analysis of the West Nile virus envelope (E) protein domain III
PDB Compounds: (C:) Genome polyprotein

SCOP Domain Sequences for d2p5pc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p5pc1 b.1.18.4 (C:300-400) Envelope glycoprotein {West Nile virus [TaxId: 11082]}
ttygvcskafkflgtpadtghgtvvlelqytgtdgpckvpissvaslndltpvgrlvtvn
pfvsvatanakvlieleppfgdsyivvgrgeqqinhhwhks

SCOP Domain Coordinates for d2p5pc1:

Click to download the PDB-style file with coordinates for d2p5pc1.
(The format of our PDB-style files is described here.)

Timeline for d2p5pc1: