SCOP 1.75: Domain d2p5pb1: 2p5p B:300-400

Lineage for d2p5pb1 (2p5p B:300-400)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (23 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (2 proteins)

6. Protein Envelope glycoprotein [49213] (5 species)

7. Species West Nile virus [TaxId:11082] [110056] (3 PDB entries)
   Uniprot Q8JU42 586-696

8. Domain d2p5pb1: 2p5p B:300-400 [149258]
   automatically matched to d1s6na_

Details for d2p5pb1

PDB Entry: 2p5p, 2.8 Å

PDB Description: Crystal Structure Analysis of the West Nile virus envelope (E) protein domain III

PDB Compounds: (B:) Genome polyprotein

SCOP Domain Sequences for d2p5pb1:

Sequence; same for both SEQRES and ATOM records:

>d2p5pb1 b.1.18.4 (B:300-400) Envelope glycoprotein {West Nile virus [TaxId: 11082]}
ttygvcskafkflgtpadtghgtvvlelqytgtdgpckvpissvaslndltpvgrlvtvn
pfvsvatanakvlieleppfgdsyivvgrgeqqinhhwhks

Timeline for d2p5pb1:

• d2p5pb1 is new in SCOP 1.75
  
• d2p5pb1 is called d2p5pb_ in SCOPe 2.01
  
• d2p5pb1 appears in the current release, SCOPe 2.08, called d2p5pb_